PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang11g14640.1
Common NameLR48_Vigan627s008600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family CO-like
Protein Properties Length: 192aa    MW: 20861.8 Da    PI: 9.6762
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang11g14640.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box23.31.3e-072060438
        zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Ht 38
                    + C+ ++   + lfC+ ++ +lC  C +++H        H+
  Vang11g14640.1 20 KPCDSCKLASAALFCRPDSAFLCIACDSKIHCAnklasrHE 60
                    78******99*********************5555666676 PP

2CCT712.9e-24119163145
             CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqae 45 
                     Rea++lRY+eKrk+RkFeK+irY+sRKa+Ae+RpR+KGrF+k+ae
  Vang11g14640.1 119 REARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRAE 163
                     9*****************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003365.4E-101764IPR000315B-box-type zinc finger
PROSITE profilePS501199.9971764IPR000315B-box-type zinc finger
PfamPF006432.1E-51961IPR000315B-box-type zinc finger
CDDcd000213.26E-82164No hitNo description
PROSITE profilePS5101716.787119161IPR010402CCT domain
PfamPF062032.5E-18119161IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 192 aa     Download sequence    Send to blast
MGIEKGGLKG FRSGWTVPPK PCDSCKLASA ALFCRPDSAF LCIACDSKIH CANKLASRHE  60
RVWMCEVSSS SLDVGVVPDG NTVSEMSYSF GRNSSESSGI GLSGVSGGQG ATQLCGMDRE  120
ARVLRYREKR KNRKFEKTIR YASRKAYAET RPRIKGRFAK RAEIDSDVER LYSPGAASLM  180
LDSPYGVVPS F*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150340.0AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014510275.13e-77PREDICTED: zinc finger protein CONSTANS-LIKE 5
SwissprotQ9FHH81e-32COL5_ARATH; Zinc finger protein CONSTANS-LIKE 5
TrEMBLA0A0L9TF492e-77A0A0L9TF49_PHAAN; Uncharacterized protein
TrEMBLA0A0S3R7U82e-77A0A0S3R7U8_PHAAN; Uncharacterized protein
STRINGGLYMA17G07420.16e-64(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13023493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57660.14e-31CONSTANS-like 5
Publications ? help Back to Top
  1. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]